If you have been reading about secretagogue and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-06-11. Where a claim depends on a specific study, the study is described rather than over-claimed.
Ipamorelin is a synthetic pentapeptide that belongs to the growth hormone secretagogue class. It acts as an agonist at the ghrelin receptor, also called the growth hormone secretagogue receptor type 1a. The compound was designed in the 1990s during a search for agents that release growth hormone with fewer off-target hormonal effects than earlier secretagogues. It appears in the research literature under several sequence-based names. Material supplied for laboratory work is normally a lyophilized solid, and it is not marketed as an approved therapeutic in major jurisdictions.
The molecule contains five residues, including alpha-aminoisobutyric acid, D-2-naphthylalanine, and D-phenylalanine, and it ends in a lysine amide. Non-natural and D-configured residues make the chain less susceptible to common peptidases, which helps explain its resistance to rapid breakdown. Its molecular formula is C38H49N9O5, corresponding to a free-base mass near 711.9 daltons. The C-terminal amide removes a negative charge and is a recurring feature in receptor-active peptides of this family. These structural choices are usually discussed as the basis for its selectivity profile.
Compared with other secretagogues such as GHRP-2, GHRP-6, and hexarelin, ipamorelin is described as more selective. Published animal work reports little or no increase in adrenocorticotropic hormone, cortisol, or prolactin at doses that release growth hormone. This selectivity is the property most often cited in the research literature. Whether the same profile holds across species and dosing schedules remains an open question, since human data are limited and come largely from small studies.
Ipamorelin is a synthetic pentapeptide that belongs to the growth hormone secretagogue family. Its sequence is Aib-His-D-2-Nal-D-Phe-Lys-NH2, and its molecular mass is approximately 711.9 daltons. The compound was described in the late 1990s by researchers seeking molecules that release growth hormone with fewer side effects than earlier secretagogues. It is a laboratory and research compound, not an approved medicine in most jurisdictions.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C38H49N9O5 | Value for the free base |
| Molar mass | 711.9 g/mol | Calculated from the formula |
| Appearance | White to off-white powder | Typical lyophilized form |
| Mechanism class | Ghrelin receptor agonist | Also described as a secretagogue |
| Half-life | About 2 hours | Reported for human circulation |
Long-term storage of the dry powder is typically at minus twenty degrees Celsius or lower, protected from light and moisture. Solutions are commonly kept frozen and thawed only once, because repeated freeze-thaw cycles can promote aggregation and loss of measurable peptide content. Buffers near neutral pH are preferred over strongly acidic or strongly basic conditions. Shipping at ambient temperature is acceptable for short periods when the powder remains sealed and desiccated.
Identity and purity are assessed by complementary methods rather than a single test. Reversed-phase high-performance liquid chromatography separates the peptide from related impurities and reports a percentage purity. Mass spectrometry, most often with electrospray ionization, confirms the expected molecular mass and detects sequence-related variants. Amino acid analysis can verify composition, while water content and residual counterion measurements support the mass balance of a batch. Stability studies under accelerated conditions are used to estimate shelf life, though such estimates carry uncertainty for long-term storage.
Ipamorelin is a synthetic pentapeptide that acts on the growth hormone secretagogue receptor, also known as the ghrelin receptor. Its sequence contains five amino acid residues, including a non-natural residue that increases stability against enzymatic breakdown. The compound was developed in the 1990s as part of research into small peptides that stimulate pituitary hormone release. Unlike larger protein hormones, it can be produced by solid-phase peptide synthesis and characterized by standard analytical methods.
At the receptor level, ipamorelin binds GHS-R1a and triggers signaling through Gq-coupled pathways. Activation leads to calcium release and downstream effects in pituitary somatotroph cells. These events promote the release of growth hormone into circulation. The response depends on the presence of the receptor and on the physiological state of the animal or tissue studied. Because the receptor is also found in other tissues, effects beyond the pituitary have been examined in laboratory models, though the extent of those effects remains an area of ongoing study.
Activity is mediated mainly through the growth hormone secretagogue receptor, now generally called the ghrelin receptor or GHS-R1a. Binding at this G-protein-coupled receptor triggers phospholipase C signaling, calcium mobilization, and release of growth hormone from pituitary somatotrophs. Reports describe less pronounced stimulation of adrenocorticotropic hormone and prolactin compared with earlier secretagogues such as hexarelin or GHRP-6. Selectivity figures vary between assay systems, so the degree of separation from other secretagogues is an area of ongoing comparison rather than a fixed constant.
In animal and early human studies, ipamorelin produces pulsatile growth hormone release and a secondary rise in insulin-like growth factor 1. The magnitude and duration of that rise depend on route, sampling schedule, and the baseline endocrine state of the subject. Whether repeated exposure alters the response over time is not firmly settled, since some reports describe stable pulsatility while others note attenuation. Most published data come from small samples, which limits the strength of any general claim about long-term behavior.
Ipamorelin is a synthetic pentapeptide that belongs to the growth hormone secretagogue class of compounds. Its sequence is Aib-His-D-2-Nal-D-Phe-Lys-NH2, a structure that differs from natural ghrelin in length and in the presence of non-natural amino acid residues. Early laboratory work described it as a comparatively selective agent that stimulates growth hormone release with limited effect on other pituitary hormones. The compound is supplied as a lyophilized solid for research use and has no identified natural source in the body.
{\displaystyle k_{\text{eff}}={\frac {(k_{p}-k_{\text{lr}})\phi _{\text{l}}k_{\text{lr}}[2\beta _{l}^{3}-\beta ^{3}+1]+(k_{\text{p}}+2k_{\text{lr}})\beta _{\text{l}}^{3}[\phi _{\text{l}}\beta ^{3}(k_{\text{lr}}-k_{\text{f}})+k_{\text{f}}]}{\beta _{\text{l}}^{3}(k_{\text{p}}+2k_{\text{lr}}-(k_{\text{p}}-k_{\text{lr}})\phi _{\text{l}}[\beta _{\text{l}}^{3}+\beta ^{3}-1])}}}
Flavoring are often added to e-liquids as well as dry smoke blends. There are currently over 7,700 e-liquid flavors available, most have not been laboratory tested for toxicity. There are numerous flavors (e.g., fruit, vanilla, caramel, coffee) of e-liquid available. There are also flavorings that resemble the taste of cigarettes.
=== Train of four ratio test === The train of four ratio (i.e., ToFr) is a neuromuscular test for monitoring neuromuscular function (see monitoring neuromuscular blockade). In this test, a peripheral nerve (most commonly the ulnar nerve) is stimulated by an electrical impulse 4 times (i.e., T1, T2, T3, T4) and the strength of contraction is measured in a muscle(s) (i.e., the abductor pollicis longus and brevis muscles for the ulnar nerve). The ratio of the amplitude of muscle contraction in response to the fourth impulse (T4) divided by the amplitude of muscle contraction in response to the first impulse is calculated. The ratio of these two contractions should be 1.0. Values less than this are regarded as abnormal. ToFr is used to determine when the effects of an administered neuromuscular-blocking drug have worn off (see postoperative residual curarization) or as the most objective, accurate, and sensitive test for determining the presence and severity of myasthenia gravis: myasthenia gravis is considered to afflict the tested muscle if its ToFr ratio (i.e., T4/T1) is less than 0.9.
== Nomenclature == Usually, a "phenyl group" is synonymous with C6H5− and is represented by the symbol Ph (archaically, Φ), or Ø. Benzene is sometimes denoted as PhH. Phenyl groups are generally attached to other atoms or groups. For example, triphenylmethane (Ph3CH) has three phenyl groups attached to the same carbon center. Many or even most phenyl compounds are not described with the term "phenyl". For example, the chloro derivative C6H5Cl is normally called chlorobenzene, although it could be called phenyl chloride. In special (and rare) cases, isolated phenyl groups are detected: the phenyl anion (C6H−5), the phenyl cation (C6H+5), and the phenyl radical (C6H•5). Although Ph and phenyl uniquely denote C6H5−, substituted derivatives also are described using the phenyl terminology. For example, C6H4NO2− is nitrophenyl, and C6F5− is pentafluorophenyl. Monosubstituted phenyl groups (that is, disubstituted benzenes) are associated with electrophilic aromatic substitution reactions and the products follow the arene substitution pattern. So, a given substituted phenyl compound has three isomers, ortho (1,2-disubstitution), meta (1,3-disubstitution) and para (1,4-disubstitution). A disubstituted phenyl compound (trisubstituted benzene) may be, for example, 1,3,5-trisubstituted or 1,2,3-trisubstituted. Higher degrees of substitution, of which the pentafluorophenyl group is an example, exist and are named according to IUPAC nomenclature.
=== Converting nucleotides to deoxynucleotides === Nucleotides are initially synthesized with ribose as the sugar component, a characteristic feature of RNA. However, DNA requires deoxyribose, which lacks the 2'-hydroxyl (-OH) group on the ribose. The removal of this -OH group is catalyzed by ribonucleotide reductase, an enzyme that converts nucleoside diphosphates (NDPs) into their deoxy forms, deoxynucleoside diphosphates (dNDPs). The nucleotides must be in the diphosphate form for this reaction to occur. To synthesize thymidine, a DNA-specific nucleotide that exists only in the deoxy form, uridine is first converted into deoxyuridine by ribonucleotide reductase. Deoxyuridine is then methylated by thymidylate synthase to produce thymidine.
Sources: en.wikipedia.org
The Kizil Caves (also romanized as Qizil or Qyzyl; Uyghur: قىزىل مىڭ ئۆي, lit. 'The Thousand Red Houses'; Chinese: 克孜尔千佛洞; lit. 'Kizil Caves of the Thousand Buddhas') are a set of Buddhist rock-cut caves located near Kizil Township (克孜尔乡; Kèzī'ěr Xiāng) in Baicheng County, Aksu Prefecture, Xinjiang, China. The site is located on the northern bank of the Muzat River 65 kilometres (40 miles) (75 km; 50 miles by road) west of Kucha. This area was a commercial hub of the Silk Road. The caves have an important role in Central Asian art and in the Silk Road transmission of Buddhism, and are said to be the earliest major Buddhist cave complex in China, with development occurring between the 3rd and 8th centuries CE. The caves of Kizil are the earlier of their type in China, and their model was later adopted in the construction of Buddhist caves further east. Another name for the site has been Ming-oi (明屋), although this term is now mainly used for the site of Shorchuk to the east. The Kizil Caves were inscribed in 2014 on the UNESCO World Heritage List as part of the Silk Roads: the Routes Network of Chang'an-Tianshan Corridor World Heritage Site.
Antimicrobial peptides generally have a net positive charge, allowing them to interact with the negatively charged molecules exposed on bacteria and cancer cell surfaces, such as phospholipid phosphatidylserine, O-glycosylated mucins, sialylated gangliosides, and heparin sulfates. The mechanism of action of these peptides varies widely but can be simplified into two categories: membranolytic and non-membranolytic antimicrobial peptides. The disruption of membranes by membranolytic antimicrobial peptides can be described by four models:
Enriched uranium was first manufactured in the early 1940s when the United States and the United Kingdom began their nuclear weapons programs. Later in the decade, France and the Soviet Union began their nuclear weapons and nuclear power programs. Depleted uranium was originally stored as an unusable waste product (uranium hexafluoride) in the hope that improved enrichment processes could extract additional quantities of the fissionable 235U isotope. This re-enrichment recovery of the residual uranium-235 is now in practice in some parts of the world; e.g. in 1996 over 6,000 tonnes (6,600 short tons) were upgraded in a Russian plant. In the 1970s, the Pentagon reported that the Soviet military had developed armor plating for Warsaw Pact tanks that NATO ammunition could not penetrate. The Pentagon began searching for materials to make denser armor-piercing projectiles. After testing various metals, ordnance researchers settled on depleted uranium. The US and NATO militaries used DU penetrator rounds in the 1991 Gulf War, the Bosnia war, bombing of Serbia, the 2003 invasion of Iraq, and 2015 airstrikes on ISIS in Syria. It is estimated that between 315 and 350 short tons (286 and 318 t) of DU were used in the 1991 Gulf War.
== Function == The protein encoded by this gene is an integral membrane protein that is similar to MHC class I-type proteins and associates with beta-2 microglobulin (beta2M). It is thought that this protein functions to regulate circulating iron uptake by regulating the interaction of the transferrin receptor with transferrin. The HFE gene contains seven exons spanning 12 kb. The full-length transcript represents six exons. HFE protein is composed of 343 amino acids. There are several components, in sequence: a signal peptide (initial part of the protein), an extracellular transferrin receptor-binding region (α1 and α2), a portion that resembles immunoglobulin molecules (α3), a transmembrane region that anchors the protein in the cell membrane, and a short cytoplasmic tail. HFE expression is subject to alternative splicing. The predominant HFE full-length transcript has ~4.2 kb. Alternative HFE splicing variants may serve as iron regulatory mechanisms in specific cells or tissues. HFE is prominent in small intestinal absorptive cells, gastric epithelial cells, tissue macrophages, and blood monocytes and granulocytes, and the syncytiotrophoblast, an iron transport tissue in the placenta.
Sources: en.wikipedia.org
=== Photodetector === A graphene/n-type silicon heterojunction has been demonstrated to exhibit strong rectifying behavior and high photoresponsivity. By introducing a thin interfacial oxide layer, the dark current of graphene/n-Si heterojunction has been reduced by two orders of magnitude at zero bias. At room temperature, the graphene/n-Si photodetector with interfacial oxide exhibits a specific detectivity up to 5.77 × 1013 cm Hz1/2 W2 at the peak wavelength of 890 nm in vacuum. In addition, the improved graphene/n-Si heterojunction photodetectors possess high responsivity of 0.73 A W−1 and high photo-to-dark current ratio of ≈107. These results demonstrate that graphene/Si heterojunction with interfacial oxide is promising for the development of high detectivity photodetectors. Recently, a graphene/si Schottky photodetector with record-fast response speed (< 25 ns) from wavelength 350 nm to 1100 nm are presented. The photodetectors exhibit excellent long-term stability even stored in air for more than 2 years. These results not only advance the development of high-performance photodetectors based on the graphene/Si Schottky junction, but also have important implications for mass-production of graphene-based photodetector array devices for cost-effective environmental monitoring, medical images, free-space communications, photoelectric smart-tracking, and integration with CMOS circuits for emerging interest-of-things applications, etc.
HN MAPRGESCLLLLTSEIDLPVKRRA S1 MCHWAGGASNTGDARGDVFGKQAG S2 MGVKFFTLSTREFPSVQRAVPLWTNS S3 MLGYNFSSFPCGTISIAPGENFYRLYFIWVNGLAKVVW S4 MLEVMELVNRRGKICRVPETFFNLSL S5 MYCSEVGFCSEVAPTEIFNAGLWV S6 MLDQDIPMVQPLLKVRLEND
718 Other derangement of joint 718.0 Articular cartilage disorder 718.1 Loose body in joint 718.2 Pathological dislocation 718.3 Recurrent dislocation of joint 718.4 Contracture of joint 718.5 Ankylosis of joint 718.6 Unspecified intrapelvic protrusion of acetabulum 718.7 Developmental dislocation of joint 719 Other and unspecified disorders of joint 719.0 Effusion/swelling of joint, unspec. 719.1 Hemarthrosis 719.2 Villonodular synovitis 719.3 Palindromic rheumatism 719.4 Joint pain, unspec. 719.5 Stiffness of joint 719.7 Difficulty in walking
Sources: en.wikipedia.org
It has not been approved as a therapeutic by major regulators, and the human trial record is small and dated. Material available today is mostly sold as a research chemical for laboratory use. Approval and restriction status varies by country.
It binds the ghrelin receptor, known as the growth hormone secretagogue receptor type 1a. Activation of that receptor triggers signaling that leads to growth hormone release. Selectivity for growth hormone over cortisol and prolactin is the property most often cited for this compound.
Published estimates place the circulating half-life at roughly two hours in humans. Clearance involves peptidase activity and renal handling. Because the peptide is short-lived, release patterns after administration are usually described as pulsatile rather than sustained.
Ipamorelin is a synthetic pentapeptide that stimulates growth hormone release by activating the ghrelin receptor. It is handled as a research tool rather than as a licensed therapeutic product. Its short chain length makes it comparatively simple to synthesize and analyze.